Human Growth Hormone (1-43),CAS :96827-07-5
Human Growth Hormone (1-43)
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-867 | 0.5mg | 230.00 | + Add to cart |
|
R-M-867 | 1mg | 360.00 | + Add to cart |
|
|
Product description
This insulin-potentiating hGH-fragment has been detected in human serum. Treatment of obese yellow Avy/A mice with hGH (1-43) enhanced the in vitro sensitivity of their adipose tissue to insulin.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 96827-07-5 |
Sequence | FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYS |
Synonyms | hGH (1-43), Somatotropin (1-43) (human), Growth Hormone (1-43), human |
Molecular Formula | C₂₄₀H₃₅₈N₆₂O₆₇S |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product